PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G10860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 428aa    MW: 45639.8 Da    PI: 8.4907
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G10860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.83.9e-23126170145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr+++ ++k+CErH++rgr+rsrk++e 
  OPUNC12G10860.1 126 DSEPGRCRRTDGKKWRCSRDAVVDQKYCERHVNRGRHRSRKHVEG 170
                      689***************************************986 PP

2QLQ55.41.8e-195590136
              QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                     ++FT++Q+++L++Q+l+yK+++an+PvP+ Ll+ i+
  OPUNC12G10860.1 55 GPFTPTQWMELEHQALIYKHIVANAPVPAGLLLTIR 90
                     59*****************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-105591IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.1E-145689IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.9015691IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.136126170IPR014977WRC domain
PfamPF088792.6E-19128169IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MATPTTNGSF LLGSGGYPGA QMLSFSSSGY SGNAGLDCGS SDVTRMQGVL ARVRGPFTPT  60
QWMELEHQAL IYKHIVANAP VPAGLLLTIR RSLHPPVFPH FSSGGILGSS SLGWGTFQLG  120
YSGSADSEPG RCRRTDGKKW RCSRDAVVDQ KYCERHVNRG RHRSRKHVEG QSSHPAKATV  180
AAIAQPLMGA SNGKSSGGHG VSHDLTKTLA TNRMLDKANL IERSQEYTNQ QHNILQNNTK  240
GENWSEEMSS QADYAVLPAS SLMNTPQSAN LNPIPQQQCC KQSLFGKGIQ HDDIQLSISI  300
PVDNSDLPTD YNTAQMDHVV GSSSNGRNNT RASWIPGSWE ASMGGPLGEF FTNTSNASDN  360
KGKSHHPPSL NLLVDGHTTS PQLQSPTGVL QMTSFSSVPS STVSSPAGSL CNGLLTSGLV  420
NAQIVQTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2415570.0AK241557.1 Oryza sativa Japonica Group cDNA, clone: J065178H17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618984.10.0PREDICTED: growth-regulating factor 7 isoform X1
SwissprotQ6AWY20.0GRF7_ORYSJ; Growth-regulating factor 7
TrEMBLA0A0E0MMF40.0A0A0E0MMF4_ORYPU; Uncharacterized protein
STRINGLOC_Os12g29980.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-46growth-regulating factor 2